PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 79245
Common NameSELMODRAFT_78396, SELMODRAFT_79245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 84aa    MW: 10176.5 Da    PI: 7.2536
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
79245genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.48.9e-103576346
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +l++d ++++ ++ +++Ia+ ++ ++t  +c+++++ 
            79245 35 PWTPEEKKLFLDKFALFYKN-FAKIASFLQ-HKTTGDCVEFYYR 76
                     8*****************99.*********.***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.12E-152082IPR009057Homeodomain-like
PROSITE profilePS5129317.2573182IPR017884SANT domain
SMARTSM007175.7E-93280IPR001005SANT/Myb domain
PfamPF002491.2E-73476IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-63479IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MILCQGERSA QYIVQSNRRV EDPIEFEQER KSINPWTPEE KKLFLDKFAL FYKNFAKIAS  60
FLQHKTTGDC VEFYYRNQKT EEFQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002962527.11e-57hypothetical protein SELMODRAFT_79245, partial
RefseqXP_002962765.11e-57hypothetical protein SELMODRAFT_78396, partial
TrEMBLD8QU311e-57D8QU31_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ359903e-57(Selaginella moellendorffii)
STRINGEFJ362283e-57(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP32151725
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.12e-24MYB family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]